| Catalog Number: 10122 |
| Product Name: Arf1 Protein Δ17 mutant |
| Synonyms: ADP-ribosylation factor 1 |
| Source: Human, recombinant, His6-tag |
| Expression Host: E. coli |
| Molecular Weight: 21 kDa |
| Purity: >95% by SDS-PAGE |
| Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
| Amino Acid Sequence (1-181, Δ17) |
MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD
VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM
NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Properties
|
| Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form): White or clear |
| Concentration: 1 mg/mL |
| Storage: -80°C |
Preparation Instructions:
Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
 |
References:
1. Amor, J. C. et al., Nature 372: 704-708, 1994.
2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989.
3. Hirai, M. et al., Genomics 34: 263-265, 1996.
4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008.
5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992.
6. Mossessova, E. et al., Cell 92: 415-423, 1998.
7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989.
8. Presley, J. F. et al., Nature 417: 187-193, 2002.
9. Renault, L. et al., Nature 426: 525-530, 2003. |
|